Skip to product information
1 of 1

IFI30, Human (HEK293, His)

IFI30, Human (HEK293, His)

Size

SKU:QM-0202762-01

£73.65 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFI30 is a lysosomal thiol reductase that plays a critical role in reducing protein disulfide bonds in the lysosomal environment. This enzymatic activity is critical for complete unfolding of proteins for lysosomal degradation. IFI30 Protein, Human (HEK293, His) is the recombinant human-derived IFI30 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    10437 (Gene_ID) P13284 (S27-K243) (Accession)

  • Smiles

    SPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202762-01
5 µgQM-0202762-01
£73.65/ea
£0.00
£73.65/ea £0.00
10 µgQM-0202762-02
10 µgQM-0202762-02
£115.00/ea
£0.00
£115.00/ea £0.00
50 µgQM-0202762-03
50 µgQM-0202762-03
£323.38/ea
£0.00
£323.38/ea £0.00
100 µgQM-0202762-04
100 µgQM-0202762-04
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IFI30, Human (HEK293, His)

IFI30, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.