IFN-alpha 4/IFNA4, Cynomolgus (HEK293, Fc)

Name: IFN-alpha 4/IFNA4, Cynomolgus (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0194766-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0194766-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 4/IFNA4 Protein, Cynomolgus (HEK293, Fc), produced in HEK293 cells with a C-terminal mFc-tag.
Molecular Formula
710654 (Gene_ID) NP_001181313 (C24-N189) (Accession)
Smiles
CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQTAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLEACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRKKN
Purity
96.5
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0194766-01	2 µgQM-0194766-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0194766-02	10 µgQM-0194766-02 £102.63/ea	£0.00	Quantity	£102.63/ea	£0.00

50 µgQM-0194766-03	50 µgQM-0194766-03 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-alpha 4/IFNA4, Cynomolgus (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.