IFN-alpha 4/IFNA4, Rat (HEK293, Fc)

Name: IFN-alpha 4/IFNA4, Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0204446-01
Price: 55.02 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204446-01

£55.02 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 4/IFNA4 Protein, Rat (HEK293, Fc) contains 166 a.a. (C24-K189), produced in HEK293 cells with a N-terminal hFc-tag.
Molecular Formula
298205 (Gene_ID) D3ZFH0 (C24-K189) (Accession)
Smiles
CDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRQDFGFPQEKVDAQQIQKAQTIPVLHELSQQVLNIFTSKDSSAAWNATLLDSFCNDLHQQLSDLKVCLMQQVGMQEPPLTQEDSLLAVREYFHRITVYLTEKKHSPCAWEVVRAEVWRALSSSVYLLAKLSEEK
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204446-01	2 µgQM-0204446-01 £55.02/ea	£0.00	Quantity	£55.02/ea	£0.00

10 µgQM-0204446-02	10 µgQM-0204446-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0204446-03	50 µgQM-0204446-03 £288.14/ea	£0.00	Quantity	£288.14/ea	£0.00

100 µgQM-0204446-04	100 µgQM-0204446-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-alpha 4/IFNA4, Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.