IFN-alpha 5/IFNA5, Rat (HEK293, C-His)

Name: IFN-alpha 5/IFNA5, Rat (HEK293, C-His)
Brand: QuantiMol
SKU: QM-0204094-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204094-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-alpha 5/IFNA5 Protein, Rat (HEK293, C-His) is the recombinant rat-derived IFN-alpha 5/IFNA5, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
690894 (Gene_ID) NP_001395720 (C24-E189) (Accession)
Smiles
CALLQQQSLRNKRALTFLTQIRRFSPVSCLKDRKDFGFPLEKMDAQQIQKTQAIPILYELTQQVLNIFTSKDSSAAWDATLLDSFCNNLHQQLNDLKACLMQQSGVQEPPLTQEDSLLYVKEYFHRISVYLREKKHSPCAWEVVRAEVWRALSSSAKLLTRQSKEE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204094-01	2 µgQM-0204094-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0204094-02	10 µgQM-0204094-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0204094-03	50 µgQM-0204094-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0204094-04	100 µgQM-0204094-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-alpha 5/IFNA5, Rat (HEK293, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.