Skip to product information
1 of 1

IFN-beta, Human (CHO)

IFN-beta, Human (CHO)

Size

SKU:QM-0205245-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFN-beta is a secretory cytokine produced by cells under viral infection or nucleic acid stimulation. IFNβ binds to cell surface heterodimeric receptors (IFNAR1/IFNAR2), activates the JAK-STAT signaling pathway, and induces the expression of interferon-stimulated genes (ISGs) (such as PKR, 2'5'-OAS) . IFN-beta inhibits viral proliferation, regulates immune responses (such as inhibiting Th1 cell polarization, reducing pro-inflammatory cytokine secretion), inhibits the proliferation of vascular smooth muscle cells and tumor cells. IFN-beta has anti-atherosclerotic and vascular remodeling effects. IFN-beta Protein, Human (CHO) is a recombinant interferon-beta protein (CHO), expressed by CHO, without a tag.

  • Molecular Formula

    3456 (Gene_ID) P01574 (M22-N187) (Accession)

  • Smiles

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205245-01
2 µgQM-0205245-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0205245-02
10 µgQM-0205245-02
£282.06/ea
£0.00
£282.06/ea £0.00
20 µgQM-0205245-03
20 µgQM-0205245-03
£420.57/ea
£0.00
£420.57/ea £0.00
50 µgQM-0205245-04
50 µgQM-0205245-04
£675.73/ea
£0.00
£675.73/ea £0.00
100 µgQM-0205245-05
100 µgQM-0205245-05
£1,051.16/ea
£0.00
£1,051.16/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IFN-beta, Human (CHO)

IFN-beta, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.