IFN-beta, Human (HEK293)

Name: IFN-beta, Human (HEK293)
Brand: QuantiMol
SKU: QM-0195903-01
Price: 199.44 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0195903-01

£199.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model[3].
Molecular Formula
3456 (Gene_ID) P01574 (M22-N187) (Accession)
Smiles
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0195903-01	10 µgQM-0195903-01 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0195903-02	50 µgQM-0195903-02 £431.51/ea	£0.00	Quantity	£431.51/ea	£0.00

100 µgQM-0195903-03	100 µgQM-0195903-03 £664.79/ea	£0.00	Quantity	£664.79/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-beta, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.