Skip to product information
1 of 1

IFN-epsilon, Human (His)

IFN-epsilon, Human (His)

Size

SKU:QM-0198253-01

£148.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFN-ε protein is a type I interferon that is critical for maintaining baseline levels of IFN-regulated genes (such as 2'-5'-oligoadenylate synthetase, IRF7, and ISG15) in the female reproductive tract. It acts as a direct mediator, providing protection against viral and bacterial genital infections. IFN-epsilon Protein, Human (His) is the recombinant human-derived IFN-epsilon protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    338376 (Gene_ID) Q86WN2 (L22-R208) (Accession)

  • Smiles

    LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

  • Purity

    91

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198253-01
5 µgQM-0198253-01
£148.75/ea
£0.00
£148.75/ea £0.00
10 µgQM-0198253-02
10 µgQM-0198253-02
£278.42/ea
£0.00
£278.42/ea £0.00
50 µgQM-0198253-03
50 µgQM-0198253-03
£689.09/ea
£0.00
£689.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IFN-epsilon, Human (His)

IFN-epsilon, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.