Name: IFN-gamma, Human
Brand: QuantiMol
SKU: QM-0076325-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.
Molecular Formula
3458 (Gene_ID) P01579 (Q24-Q166) (Accession)
Smiles
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0076325-01	2 µgQM-0076325-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0076325-02	5 µgQM-0076325-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0076325-03	10 µgQM-0076325-03 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0076325-04	50 µgQM-0076325-04 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

100 µgQM-0076325-05	100 µgQM-0076325-05 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

250 µgQM-0076325-06	250 µgQM-0076325-06 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

1 mgQM-0076325-07	1 mgQM-0076325-07 £1,013.50/ea	£0.00	Quantity	£1,013.50/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-gamma, Human

IFN-gamma, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.