IFN-gamma, Mouse (HEK293, His)

Name: IFN-gamma, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0180356-01
Price: 78.82 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180356-01

£78.82 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
15978 (Gene_ID) P01580 (H23-C155) (Accession)
Smiles
HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180356-01	10 µgQM-0180356-01 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

50 µgQM-0180356-02	50 µgQM-0180356-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-gamma, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.