Skip to product information
1 of 1

IFN-gamma, Mouse (HEK293, His)

IFN-gamma, Mouse (HEK293, His)

Size

SKU:QM-0180356-01

£78.82 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    15978 (Gene_ID) P01580 (H23-C155) (Accession)

  • Smiles

    HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180356-01
10 µgQM-0180356-01
£78.82/ea
£0.00
£78.82/ea £0.00
50 µgQM-0180356-02
50 µgQM-0180356-02
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IFN-gamma, Mouse (HEK293, His)

IFN-gamma, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.