Skip to product information
1 of 1

IFN-gamma, Porcine

IFN-gamma, Porcine

Size

SKU:QM-0203933-01

£100.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells. It plays a key role in antibacterial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. effect. Its main signaling pathway involves the JAK-STAT pathway that interacts with its receptor IFNGR1, affecting gene regulation. IFN-gamma Protein, Pig is the recombinant Pig-derived IFN-gamma protein, expressed by E. coli , with tag free.

  • Molecular Formula

    396991 (Gene_ID) P17803 (S21-K166) (Accession)

  • Smiles

    SYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203933-01
5 µgQM-0203933-01
£100.38/ea
£0.00
£100.38/ea £0.00
10 µgQM-0203933-02
10 µgQM-0203933-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0203933-03
50 µgQM-0203933-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0203933-04
100 µgQM-0203933-04
£708.53/ea
£0.00
£708.53/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IFN-gamma, Porcine

IFN-gamma, Porcine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.