IFN-gamma, Rat

Name: IFN-gamma, Rat
Brand: QuantiMol
SKU: QM-0203988-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203988-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-gamma Protein, Rat is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Molecular Formula
25712 (Gene_ID) P01581 (G24-C156) (Accession)
Smiles
GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203988-01	2 µgQM-0203988-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203988-02	10 µgQM-0203988-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0203988-03	50 µgQM-0203988-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

100 µgQM-0203988-04	100 µgQM-0203988-04 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-gamma, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.