IFN-omega 1, Human (HEK293, His)

Name: IFN-omega 1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0077672-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0077672-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IFN-omega protein is a member of the alpha/beta interferon family. IFN-omega 1 Protein, Human (HEK293, His) is the recombinant human-derived IFN-omega protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
3467 (Gene_ID) P05000 (L22-S195) (Accession)
Smiles
LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0077672-01	5 µgQM-0077672-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0077672-02	10 µgQM-0077672-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0077672-03	50 µgQM-0077672-03 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

100 µgQM-0077672-04	100 µgQM-0077672-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IFN-omega 1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.