Skip to product information
1 of 1

IGF-I/IGF-1, Mouse (N-His)

IGF-I/IGF-1, Mouse (N-His)

Size

SKU:QM-0202361-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

  • Smiles

    GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202361-01
2 µgQM-0202361-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0202361-02
10 µgQM-0202361-02
£89.13/ea
£0.00
£89.13/ea £0.00
50 µgQM-0202361-03
50 µgQM-0202361-03
£197.01/ea
£0.00
£197.01/ea £0.00
100 µgQM-0202361-04
100 µgQM-0202361-04
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IGF-I/IGF-1, Mouse (N-His)

IGF-I/IGF-1, Mouse (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.