Skip to product information
1 of 1

IGFBP-7, Mouse (HEK293, Fc)

IGFBP-7, Mouse (HEK293, Fc)

Size

SKU:QM-0204947-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IGFBP-7 Protein is a member of the insulin-like growth factor binding protein (IGFBP) Family. The major function of IGFBP-7 is the regulation of availability of insulin-like growth factors (IGFs) in tissue as well as in modulating IGF binding to its receptors. IGFBP7 exhibits a relatively low affinity for binding to both IGF-I and IGF-II. Furthermore, it has the capacity to stimulate the production of prostacyclin (PGI2) and enhance cell adhesion. IGFBP-7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    29817 (Gene_ID) AAH92538.1 (S26-L281) (Accession)

  • Smiles

    SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204947-01
2 µgQM-0204947-01
£58.12/ea
£0.00
£58.12/ea £0.00
5 µgQM-0204947-02
5 µgQM-0204947-02
£92.50/ea
£0.00
£92.50/ea £0.00
10 µgQM-0204947-03
10 µgQM-0204947-03
£133.00/ea
£0.00
£133.00/ea £0.00
50 µgQM-0204947-04
50 µgQM-0204947-04
£282.06/ea
£0.00
£282.06/ea £0.00
100 µgQM-0204947-05
100 µgQM-0204947-05
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IGFBP-7, Mouse (HEK293, Fc)

IGFBP-7, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.