Skip to product information
1 of 1

IGFBP-7, Mouse (HEK293, His)

IGFBP-7, Mouse (HEK293, His)

Size

SKU:QM-0180415-01

£188.51 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IGFBP-7 protein has moderate affinity to bind to IGF-I and IGF-II and significantly stimulates the production of prostacyclin (PGI2) . In addition to its interaction with insulin-like growth factors, IGFBP-7 also contributes to cell adhesion, suggesting its role in adhesion-related cellular processes and potential effects on cell-matrix interactions. IGFBP-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    29817 (Gene_ID) Q61581 (S26-L281) (Accession)

  • Smiles

    SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0180415-01
10 µgQM-0180415-01
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0180415-02
50 µgQM-0180415-02
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IGFBP-7, Mouse (HEK293, His)

IGFBP-7, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.