Skip to product information
1 of 1

IGFL1, Mouse (His-SUMO)

IGFL1, Mouse (His-SUMO)

Size

SKU:QM-0092633

Price on request
Quantity

Request quote or documents

View full details
  • Description

    IGFL1 Protein likely acts as a ligand for the IGFLR1 cell membrane receptor, forming a homodimer through disulfide bonds. IGFL1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived IGFL1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    232925 (Gene_ID) Q6B9Z0 (R25-P140) (Accession)

  • Smiles

    RKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0092633
1 EachQM-0092633
£0.00/ea
£0.00
£0.00/ea £0.00

IGFL1, Mouse (His-SUMO)

IGFL1, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.