IgG, Rabbit (T185A, N284S, HEK293)

Name: IgG, Rabbit (T185A, N284S, HEK293)
Brand: QuantiMol
SKU: QM-0075383-01
Price: 96.58 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0075383-01

£96.58 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IgG protein, exhibits the D12 allotypic marker with the 104-Thr sequence and the E14 marker with 185-Thr. IgG Protein, Rabbit (T185A, N284S, HEK293) is the recombinant Rabbit-derived IgG protein, expressed by HEK293 , with tag free.
Molecular Formula
100009097 (Gene_ID) P01870 (S101-K323, T185A, N284S) (Accession)
Smiles
SKPTCPPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRSPGK
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0075383-01	5 µgQM-0075383-01 £96.58/ea	£0.00	Quantity	£96.58/ea	£0.00

10 µgQM-0075383-02	10 µgQM-0075383-02 £136.63/ea	£0.00	Quantity	£136.63/ea	£0.00

50 µgQM-0075383-03	50 µgQM-0075383-03 £335.01/ea	£0.00	Quantity	£335.01/ea	£0.00

100 µgQM-0075383-04	100 µgQM-0075383-04 £517.26/ea	£0.00	Quantity	£517.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG, Rabbit (T185A, N284S, HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.