Name: IgG1, Human (D239E, L241M, HEK293)
Brand: QuantiMol
SKU: QM-0205534-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (D239E, L241M, HEK293) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with tag free.
Molecular Formula
3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241M) (Accession)
Smiles
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205534-01	5 µgQM-0205534-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205534-02	10 µgQM-0205534-02 £74.68/ea	£0.00	Quantity	£74.68/ea	£0.00

50 µgQM-0205534-03	50 µgQM-0205534-03 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

100 µgQM-0205534-04	100 µgQM-0205534-04 £235.90/ea	£0.00	Quantity	£235.90/ea	£0.00

500 µgQM-0205534-05	500 µgQM-0205534-05 £421.79/ea	£0.00	Quantity	£421.79/ea	£0.00

1 mgQM-0205534-06	1 mgQM-0205534-06 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG1, Human (D239E, L241M, HEK293)

IgG1, Human (D239E, L241M, HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.