IgG2A Fc, Mouse (HEK293)

Name: IgG2A Fc, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0187610-01
Price: 65.37 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0187610-01

£65.37 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Ig gamma-2A chain C region (Immunoglobulin heavy chain gamma polypeptide) is one of the five types of mammalian immunoglobulin heavy chain: γ, δ, α, μ and ε. Heavy chain γ defines the classes of immunoglobulins IgG[1]. IgG2A Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
Molecular Formula
380793 (Gene_ID) P01863 (P99-K330) (Accession)
Smiles
PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0187610-01	10 µgQM-0187610-01 £65.37/ea	£0.00	Quantity	£65.37/ea	£0.00

50 µgQM-0187610-02	50 µgQM-0187610-02 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG2A Fc, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.