IgG2B Fc, Llama (HEK293)

Name: IgG2B Fc, Llama (HEK293)
Brand: QuantiMol
SKU: QM-0205259-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205259-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IgG2B Fc Protein, Llama (HEK293) is the recombinant IgG2B Fc protein, expressed by HEK293, with tag free.
Molecular Formula
/ (Gene_ID) AAX73259.1 (E1-S243) (Accession)
Smiles
EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205259-01	5 µgQM-0205259-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205259-02	10 µgQM-0205259-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205259-03	50 µgQM-0205259-03 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

100 µgQM-0205259-04	100 µgQM-0205259-04 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

500 µgQM-0205259-05	500 µgQM-0205259-05 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG2B Fc, Llama (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.