IgG2B Fc, Mouse (HEK293)

Name: IgG2B Fc, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0184869-01
Price: 52.94 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0184869-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.
Molecular Formula
16016 (Gene_ID) P01867-2 (E97-K335) (Accession)
Smiles
EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184869-01	10 µgQM-0184869-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

50 µgQM-0184869-02	50 µgQM-0184869-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG2B Fc, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.