IgG3 Fc, Human (HEK293)

Name: IgG3 Fc, Human (HEK293)
Brand: QuantiMol
SKU: QM-0192064-01
Price: 60.19 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0192064-01

£60.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. IgG3 Fc Protein, Human (HEK293) is the recombinant human-derived IgG3 Fc protein, expressed by HEK293 , with tag free.
Molecular Formula
3502 (Gene_ID) P01860-1 (E99-K377) (Accession)
Smiles
ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0192064-01	10 µgQM-0192064-01 £60.19/ea	£0.00	Quantity	£60.19/ea	£0.00

50 µgQM-0192064-02	50 µgQM-0192064-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IgG3 Fc, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.