IHH, Human

Name: IHH, Human
Brand: QuantiMol
SKU: QM-0204451-01
Price: 122.88 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204451-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.
Molecular Formula
3549 (Gene_ID) Q14623 (G29-G202) (Accession)
Smiles
GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204451-01	5 µgQM-0204451-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

10 µgQM-0204451-02	10 µgQM-0204451-02 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0204451-03	50 µgQM-0204451-03 £481.32/ea	£0.00	Quantity	£481.32/ea	£0.00

100 µgQM-0204451-04	100 µgQM-0204451-04 £741.34/ea	£0.00	Quantity	£741.34/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IHH, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.