Skip to product information
1 of 1

IL-1 alpha, Human

IL-1 alpha, Human

Size

SKU:QM-0203136-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-1 alpha is a ubiquitous and pivotal pro-inflammatory cytokine. IL-1 alpha is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. IL-1 alpha plays an important role in inflammation and bridges the innate and adaptive immune systems. IL-1 alpha mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways[1][4]. IL-1 alpha protein, Human is a recombinant protein consisting of 159 amino acids (S113-A271) and is produced by E. coli.

  • Molecular Formula

    3552 (Gene_ID) P01583 (S113-A271) (Accession)

  • Smiles

    SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203136-01
2 µgQM-0203136-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0203136-02
10 µgQM-0203136-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0203136-03
50 µgQM-0203136-03
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0203136-04
100 µgQM-0203136-04
£580.96/ea
£0.00
£580.96/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-1 alpha, Human

IL-1 alpha, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.