Name: IL-1 beta, Human
Brand: QuantiMol
SKU: QM-0075892-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli. IL-1 beta Protein, Human consists of 153 amino acids (A117-S269) and is expressed in E. coli.
Molecular Formula
3553 (Gene_ID) P01584 (A117-S269) (Accession)
Smiles
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0075892-01	2 µgQM-0075892-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0075892-02	10 µgQM-0075892-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0075892-03	50 µgQM-0075892-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0075892-04	100 µgQM-0075892-04 £504.41/ea	£0.00	Quantity	£504.41/ea	£0.00

250 µgQM-0075892-05	250 µgQM-0075892-05 £879.85/ea	£0.00	Quantity	£879.85/ea	£0.00

500 µgQM-0075892-06	500 µgQM-0075892-06 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

1 mgQM-0075892-07	1 mgQM-0075892-07 £1,986.71/ea	£0.00	Quantity	£1,986.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-1 beta, Human

IL-1 beta, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.