IL-1 beta, Human (CHO)

Name: IL-1 beta, Human (CHO)
Brand: QuantiMol
SKU: QM-0202387-01
Price: 94.75 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202387-01

£94.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Human (CHO) is produced in CHO cells, and consists of 153 amino acids (A117-S269) .
Molecular Formula
3553 (Gene_ID) P01584 (A117-S269) (Accession)
Smiles
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202387-01	2 µgQM-0202387-01 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

10 µgQM-0202387-02	10 µgQM-0202387-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0202387-03	50 µgQM-0202387-03 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

100 µgQM-0202387-04	100 µgQM-0202387-04 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-1 beta, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.