IL-1 beta, Mouse

Name: IL-1 beta, Mouse
Brand: QuantiMol
SKU: QM-0203532-01
Price: 107.13 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203532-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.
Molecular Formula
16176 (Gene_ID) P10749 (V118-S269) (Accession)
Smiles
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203532-01	2 µgQM-0203532-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

10 µgQM-0203532-02	10 µgQM-0203532-02 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

50 µgQM-0203532-03	50 µgQM-0203532-03 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

100 µgQM-0203532-04	100 µgQM-0203532-04 £1,103.40/ea	£0.00	Quantity	£1,103.40/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-1 beta, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.