Skip to product information
1 of 1

IL-1 beta, Rat (His)

IL-1 beta, Rat (His)

Size

SKU:QM-0203455-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

  • Smiles

    VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203455-01
2 µgQM-0203455-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203455-02
10 µgQM-0203455-02
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0203455-03
50 µgQM-0203455-03
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0203455-04
100 µgQM-0203455-04
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-1 beta, Rat (His)

IL-1 beta, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.