Name: IL-1 beta, Rhesus macaque
Brand: QuantiMol
SKU: QM-0205453-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Rhesus macaque consists of 153 amino acids (A117-S269) and is expressed in E. coli.
Molecular Formula
704701 (Gene_ID) P48090 (A117-S269) (Accession)
Smiles
APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205453-01	2 µgQM-0205453-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205453-02	10 µgQM-0205453-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

20 µgQM-0205453-03	20 µgQM-0205453-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0205453-04	50 µgQM-0205453-04 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

100 µgQM-0205453-05	100 µgQM-0205453-05 £537.21/ea	£0.00	Quantity	£537.21/ea	£0.00

500 µgQM-0205453-06	500 µgQM-0205453-06 £1,412.02/ea	£0.00	Quantity	£1,412.02/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-1 beta, Rhesus macaque

IL-1 beta, Rhesus macaque is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.