Skip to product information
1 of 1

IL-10, Canine

IL-10, Canine

Size

SKU:QM-0201994-01

£257.76 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T+ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    403628 (Gene_ID) XP_855560 (S20-I179) (Accession)

  • Smiles

    SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201994-01
5 µgQM-0201994-01
£257.76/ea
£0.00
£257.76/ea £0.00
10 µgQM-0201994-02
10 µgQM-0201994-02
£381.69/ea
£0.00
£381.69/ea £0.00
50 µgQM-0201994-03
50 µgQM-0201994-03
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-10, Canine

IL-10, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.