IL-10, Human

Name: IL-10, Human
Brand: QuantiMol
SKU: QM-0201368-01
Price: 70.54 GBP
Availability: InStock

Size 2 µg 10 µg 20 µg 50 µg 100 µg

SKU:QM-0201368-01

£70.54 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.
Molecular Formula
3586 (Gene_ID) P22301/NP_000563.1 (S19-N178) (Accession)
Smiles
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Purity
97.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201368-01	2 µgQM-0201368-01 £70.54/ea	£0.00	Quantity	£70.54/ea	£0.00

10 µgQM-0201368-02	10 µgQM-0201368-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

20 µgQM-0201368-03	20 µgQM-0201368-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

50 µgQM-0201368-04	50 µgQM-0201368-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0201368-05	100 µgQM-0201368-05 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-10, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.