IL-10, Rat

Name: IL-10, Rat
Brand: QuantiMol
SKU: QM-0202647-01
Price: 73.65 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202647-01

£73.65 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-10 Protein, Rat is an immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.
Molecular Formula
25325 (Gene_ID) P29456 (S19-N178) (Accession)
Smiles
SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202647-01	2 µgQM-0202647-01 £73.65/ea	£0.00	Quantity	£73.65/ea	£0.00

10 µgQM-0202647-02	10 µgQM-0202647-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0202647-03	50 µgQM-0202647-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0202647-04	100 µgQM-0202647-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-10, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.