IL-10R beta, Mouse (HEK293, His)

Name: IL-10R beta, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0205443-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205443-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W223-Y251) with a His tag at the C-terminus[3].
Molecular Formula
16155 (Gene_ID) Q8VHM7 (M22-S222) (Accession)
Smiles
MIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205443-01	2 µgQM-0205443-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205443-02	10 µgQM-0205443-02 £115.00/ea	£0.00	Quantity	£115.00/ea	£0.00

50 µgQM-0205443-03	50 µgQM-0205443-03 £323.38/ea	£0.00	Quantity	£323.38/ea	£0.00

100 µgQM-0205443-04	100 µgQM-0205443-04 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

500 µgQM-0205443-05	500 µgQM-0205443-05 £1,356.13/ea	£0.00	Quantity	£1,356.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-10R beta, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.