IL-11, Human

Name: IL-11, Human
Brand: QuantiMol
SKU: QM-0203333-01
Price: 117.25 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203333-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-11 Protein, Human is a protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.
Molecular Formula
3589 (Gene_ID) P20809-1 (P22-L199) (Accession)
Smiles
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203333-01	5 µgQM-0203333-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

10 µgQM-0203333-02	10 µgQM-0203333-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0203333-03	50 µgQM-0203333-03 £398.70/ea	£0.00	Quantity	£398.70/ea	£0.00

100 µgQM-0203333-04	100 µgQM-0203333-04 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-11, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.