Skip to product information
1 of 1

IL-11, Mouse (HEK293)

IL-11, Mouse (HEK293)

Size

SKU:QM-0191609-01

£73.65 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-11 Protein, Mouse (HEK293) is a HEK293 cell derived pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types.

  • Molecular Formula

    16156 (Gene_ID) P47873 (G23-L199) (Accession)

  • Smiles

    GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0191609-01
2 µgQM-0191609-01
£73.65/ea
£0.00
£73.65/ea £0.00
10 µgQM-0191609-02
10 µgQM-0191609-02
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0191609-03
50 µgQM-0191609-03
£448.52/ea
£0.00
£448.52/ea £0.00
100 µgQM-0191609-04
100 µgQM-0191609-04
£691.52/ea
£0.00
£691.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-11, Mouse (HEK293)

IL-11, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.