IL-11, Mouse (HEK293)

Name: IL-11, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0191609-01
Price: 73.65 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0191609-01

£73.65 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-11 Protein, Mouse (HEK293) is a HEK293 cell derived pleiotropic cytokine that regulates cell cycle, invasion, and migration in numerous cell types.
Molecular Formula
16156 (Gene_ID) P47873 (G23-L199) (Accession)
Smiles
GPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0191609-01	2 µgQM-0191609-01 £73.65/ea	£0.00	Quantity	£73.65/ea	£0.00

10 µgQM-0191609-02	10 µgQM-0191609-02 £193.37/ea	£0.00	Quantity	£193.37/ea	£0.00

50 µgQM-0191609-03	50 µgQM-0191609-03 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

100 µgQM-0191609-04	100 µgQM-0191609-04 £691.52/ea	£0.00	Quantity	£691.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-11, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.