IL-11, Mouse (HEK293, Fc)

Name: IL-11, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0173835-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0173835-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-11 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
16156 (Gene_ID) P47873 (P22-L199) (Accession)
Smiles
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity
96.5
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0173835-01	2 µgQM-0173835-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0173835-02	10 µgQM-0173835-02 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0173835-03	50 µgQM-0173835-03 £448.52/ea	£0.00	Quantity	£448.52/ea	£0.00

100 µgQM-0173835-04	100 µgQM-0173835-04 £691.52/ea	£0.00	Quantity	£691.52/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-11, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.