IL-11 Protein, Human (CHO)

Name: IL-11 Protein, Human (CHO)
Brand: QuantiMol
SKU: QM-0202052-01
Price: 115.0 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202052-01

£115.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.
Molecular Formula
3589 (Gene_ID) P20809-1 (P22-L199) (Accession)
Smiles
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202052-01	5 µgQM-0202052-01 £115.00/ea	£0.00	Quantity	£115.00/ea	£0.00

10 µgQM-0202052-02	10 µgQM-0202052-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0202052-03	50 µgQM-0202052-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

100 µgQM-0202052-04	100 µgQM-0202052-04 £758.35/ea	£0.00	Quantity	£758.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-11 Protein, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.