Name: IL-12, Human (HEK293)
Brand: QuantiMol
SKU: QM-0201837-01
Price: 75.72 GBP
Availability: InStock

Product Details

Description
IL-12 Protein, Human (HEK293) is a HEK293 cell derived heterodimeric, pro-inflammatory cytokine.
Molecular Formula
3592&3593 (Gene_ID) P29459 (R23-S219) &P29460 (I23-S328) (Accession)
Smiles
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0201837-01	2 µgQM-0201837-01 £75.72/ea	£0.00	Quantity	£75.72/ea	£0.00

10 µgQM-0201837-02	10 µgQM-0201837-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

50 µgQM-0201837-03	50 µgQM-0201837-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

100 µgQM-0201837-04	100 µgQM-0201837-04 £793.58/ea	£0.00	Quantity	£793.58/ea	£0.00

500 µgQM-0201837-05	500 µgQM-0201837-05 £1,821.47/ea	£0.00	Quantity	£1,821.47/ea	£0.00

1 mgQM-0201837-06	1 mgQM-0201837-06 £2,872.45/ea	£0.00	Quantity	£2,872.45/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-12, Human (HEK293)

IL-12, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.