Skip to product information
1 of 1

IL-12, Mouse (HEK293)

IL-12, Mouse (HEK293)

Size

SKU:QM-0202873-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-12 protein is a immune-suppressive heterodimeric cytokine, composed by IL-12A subunit (IL-12p35) and IL-12B subunit (IL-12p40), is naturally produced by dendritic cells[1]. IL-12 exerts functions to activate and link the innate and acquired immune responses[2]. IL-12 Protein, Mouse is produced in HEK293 cells, with tag free.

  • Molecular Formula

    16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

  • Smiles

    RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202873-01
2 µgQM-0202873-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0202873-02
10 µgQM-0202873-02
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0202873-03
50 µgQM-0202873-03
£614.98/ea
£0.00
£614.98/ea £0.00
100 µgQM-0202873-04
100 µgQM-0202873-04
£1,009.85/ea
£0.00
£1,009.85/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-12, Mouse (HEK293)

IL-12, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.