IL-13, Human (CHO)

Name: IL-13, Human (CHO)
Brand: QuantiMol
SKU: QM-0202414-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202414-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-13 Protein, Human (CHO) is a CHO cell derived cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation.
Molecular Formula
3596 (Gene_ID) P35225 (S33-N146) (Accession)
Smiles
SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202414-01	2 µgQM-0202414-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0202414-02	5 µgQM-0202414-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

10 µgQM-0202414-03	10 µgQM-0202414-03 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0202414-04	50 µgQM-0202414-04 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

100 µgQM-0202414-05	100 µgQM-0202414-05 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-13, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.