IL-13, Mouse

Name: IL-13, Mouse
Brand: QuantiMol
SKU: QM-0076792-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0076792-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].
Molecular Formula
16163 (Gene_ID) P20109 (S26-F131) (Accession)
Smiles
SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0076792-01	2 µgQM-0076792-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0076792-02	10 µgQM-0076792-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0076792-03	50 µgQM-0076792-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0076792-04	100 µgQM-0076792-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

500 µgQM-0076792-05	500 µgQM-0076792-05 £1,599.13/ea	£0.00	Quantity	£1,599.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-13, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.