IL-13, Rat

Name: IL-13, Rat
Brand: QuantiMol
SKU: QM-0027543-01
Price: 111.63 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0027543-01

£111.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-13 Protein, Rat is a cytokine secreted by many cell types, but especially T helper type 2 (Th2) cells, that is an important mediator of allergic inflammation and disease.
Molecular Formula
116553 (Gene_ID) P42203 (T19-H131) (Accession)
Smiles
TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0027543-01	2 µgQM-0027543-01 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

10 µgQM-0027543-02	10 µgQM-0027543-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

50 µgQM-0027543-03	50 µgQM-0027543-03 £802.09/ea	£0.00	Quantity	£802.09/ea	£0.00

100 µgQM-0027543-04	100 µgQM-0027543-04 £1,245.56/ea	£0.00	Quantity	£1,245.56/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-13, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.