Skip to product information
1 of 1

IL-13R alpha 2, Mouse (HEK293, Fc)

IL-13R alpha 2, Mouse (HEK293, Fc)

Size

SKU:QM-0128056

£515.35 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-13R alpha 2 Protein, acting as a monomer, displays a strong binding affinity for interleukin-13 (IL-13) . IL-13R alpha 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-mFc labeled tag.

  • Molecular Formula

    16165 (Gene_ID) O88786-1 (L22-K334) (Accession)

  • Smiles

    LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

  • Purity

    96.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0128056
50 µgQM-0128056
£515.35/ea
£0.00
£515.35/ea £0.00

IL-13R alpha 2, Mouse (HEK293, Fc)

IL-13R alpha 2, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.