IL-13R alpha 2, Mouse (HEK293, His)

Name: IL-13R alpha 2, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0205378-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0205378-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
16165 (Gene_ID) O88786-1/NP_032382.1 (L22-K334) (Accession)
Smiles
LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205378-01	2 µgQM-0205378-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0205378-02	5 µgQM-0205378-02 £77.78/ea	£0.00	Quantity	£77.78/ea	£0.00

10 µgQM-0205378-03	10 µgQM-0205378-03 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0205378-04	50 µgQM-0205378-04 £342.81/ea	£0.00	Quantity	£342.81/ea	£0.00

100 µgQM-0205378-05	100 µgQM-0205378-05 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-13R alpha 2, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.