Skip to product information
1 of 1

IL-15, Human

IL-15, Human

Size

SKU:QM-0203812-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-15 Protein, Human modulates immune cells of both the innate and adaptive immune systems, induces the production of chemokines and cytokines, stimulates the proliferation of natural killer cells, T-cells and B-cells. IL-15 Protein, Human triggers both pro-inflammatory and protective immune responses. IL-15 Protein, Human is the recombinant human-derived IL-15 Protein, expressed by E. coli.

  • Molecular Formula

    3600 (Gene_ID) P40933-1 (N49-S162) (Accession)

  • Smiles

    NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203812-01
2 µgQM-0203812-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0203812-02
10 µgQM-0203812-02
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0203812-03
50 µgQM-0203812-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0203812-04
100 µgQM-0203812-04
£669.65/ea
£0.00
£669.65/ea £0.00
1 mgQM-0203812-05
1 mgQM-0203812-05
£2,469.07/ea
£0.00
£2,469.07/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-15, Human

IL-15, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.