IL-15, Human (His)

Name: IL-15, Human (His)
Brand: QuantiMol
SKU: QM-0203234-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203234-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-15 Protein, Human (His) is a cytokine for immune cell stimulation, increases the proliferation and persistence of natural killer (NK) and T cells.
Molecular Formula
3600 (Gene_ID) P40933-1 (N49-S162) (Accession)
Smiles
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203234-01	2 µgQM-0203234-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0203234-02	10 µgQM-0203234-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0203234-03	50 µgQM-0203234-03 £470.39/ea	£0.00	Quantity	£470.39/ea	£0.00

100 µgQM-0203234-04	100 µgQM-0203234-04 £680.59/ea	£0.00	Quantity	£680.59/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-15, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.