IL-15, Rat

Name: IL-15, Rat
Brand: QuantiMol
SKU: QM-0026521-01
Price: 271.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0026521-01

£271.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-15 Protein, Rat is the recombinant rat-derived IL-15 protein, expressed by E. coli, with tag free tag.
Molecular Formula
25670 (Gene_ID) P97604-1 (N49-S162) with an N-terminal M (Accession)
Smiles
MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0026521-01	10 µgQM-0026521-01 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

50 µgQM-0026521-02	50 µgQM-0026521-02 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-15, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.