Skip to product information
1 of 1

IL-15R alpha & IL-15, Human (HEK293, His)

IL-15R alpha & IL-15, Human (HEK293, His)

Size

SKU:QM-0206017-01

£55.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM) . IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, His) is a recombinant human IL-15R alpha (I31-S108) & IL-15 (N49-S162) fusion protein with a C-Terminal His tag, which is produced in HEK293 cells.

  • Molecular Formula

    3601&3600 (Gene_ID) Q13261-1 (I31-S108) &P40933-1 (N49-S162) (Accession)

  • Smiles

    ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSGGSGGGGSGGGSGGGGSGGNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0206017-01
2 µgQM-0206017-01
£55.02/ea
£0.00
£55.02/ea £0.00
10 µgQM-0206017-02
10 µgQM-0206017-02
£109.38/ea
£0.00
£109.38/ea £0.00
20 µgQM-0206017-03
20 µgQM-0206017-03
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0206017-04
50 µgQM-0206017-04
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0206017-05
100 µgQM-0206017-05
£520.20/ea
£0.00
£520.20/ea £0.00
250 µgQM-0206017-06
250 µgQM-0206017-06
£935.74/ea
£0.00
£935.74/ea £0.00
500 µgQM-0206017-07
500 µgQM-0206017-07
£1,433.88/ea
£0.00
£1,433.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-15R alpha & IL-15, Human (HEK293, His)

IL-15R alpha & IL-15, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.