Name: IL-16, Mouse
Brand: QuantiMol
SKU: QM-0027555-01
Price: 99.25 GBP
Availability: InStock

Product Details

Description
IL-16 Protein, a cytokine, plays a significant role in immune regulation and inflammation. It modulates the activation and migration of various immune cells, such as T cells and monocytes. Understanding the functions of IL-16 Protein can aid in studying immune responses and developing targeted therapies for inflammatory and autoimmune diseases. IL-16 Protein, Mouse is the recombinant mouse-derived IL-16 protein, expressed by E. coli , with tag free.
Molecular Formula
16170 (Gene_ID) O54824 (S1205-S1322) (Accession)
Smiles
SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0027555-01	5 µgQM-0027555-01 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

10 µgQM-0027555-02	10 µgQM-0027555-02 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

50 µgQM-0027555-03	50 µgQM-0027555-03 £354.96/ea	£0.00	Quantity	£354.96/ea	£0.00

100 µgQM-0027555-04	100 µgQM-0027555-04 £542.08/ea	£0.00	Quantity	£542.08/ea	£0.00

500 µgQM-0027555-05	500 µgQM-0027555-05 £1,527.44/ea	£0.00	Quantity	£1,527.44/ea	£0.00

1 mgQM-0027555-06	1 mgQM-0027555-06 £2,263.73/ea	£0.00	Quantity	£2,263.73/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-16, Mouse

IL-16, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.