1 1

IL-17A/F Heterodimer, Mouse (Biotinylated, HEK293, His-Avi)

IL-17A/F Heterodimer, Mouse (Biotinylated, HEK293, His-Avi)

Size

QM-0196831-01

£454.60 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13) . IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F[1][2][3][4]. IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant mouse IL-17A-17F heterodimer protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

  • Molecular Formula

    16171&257630 (Gene_ID) Q62386 (A26-A158) &Q7TNI7-1 (R29-A161) (Accession)

  • Smiles

    AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA&RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0196831-01
20 µgQM-0196831-01
£454.60/ea		 £0.00
£454.60/ea £0.00
50 µgQM-0196831-02
50 µgQM-0196831-02
£836.11/ea		 £0.00
£836.11/ea £0.00
100 µgQM-0196831-03
100 µgQM-0196831-03
£1,273.51/ea		 £0.00
£1,273.51/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

IL-17A/F Heterodimer, Mouse (Biotinylated, HEK293, His-Avi)

IL-17A/F Heterodimer, Mouse (Biotinylated, HEK293, His-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.